HIF1A Alpha Rabbit polyclonal antibody

Größe

£152.00

SKU:: A11945
Zusätzliche Namen:: bHLHe78|HIF-1-alpha|HIF-1A|HIF-1alpha|HIF1|HIF1-ALPHA|HIF1A Alpha|MOP1|PASD8
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 120 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPS
Uniprot:: Q16665
Synonyme:: ARNT interacting protein;ARNT-interacting protein;basic-helix-loop-helix-PAS protein MOP1;bHLHe78;class E basic helix-loop-helix protein 78;HIF-1-alpha;HIF-1A;HIF-1alpha;HIF1;HIF1-ALPHA;hypoxia inducible factor 1 alpha subunit;hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor);hypoxia-inducible factor 1-alpha;hypoxia-inducible factor1alpha;member of PAS protein 1;member of PAS superfamily 1;MOP1;PAS domain-containing protein 8;PAS domain-containing protein 8", "Class E basic helix-loop-helix protein 78", "Member of PAS protein 1;PASD8
Weitere Details:: This gene encodes the alpha subunit of transcription factor hypoxia-inducible factor-1 (HIF-1), which is a heterodimer composed of an alpha and a beta subunit. HIF-1 functions as a master regulator of cellular and systemic homeostatic response to hypoxia by activating transcription of many genes, including those involved in energy metabolism, angiogenesis, apoptosis, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. HIF-1 thus plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

Versandbedingungen:: Blue Ice