KRAS Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1190
Zusätzliche Namen:: 'C-K-RAS|C-K-RAS|c-Ki-ras|c-Ki-ras2|CFC2|K-Ras|K-Ras 2|K-RAS2A|K-RAS2B|K-RAS4A|K-RAS4B|KI-RAS|KRAS|KRAS1|KRAS2|NS|NS3|OES|RALD|RASK2
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 21 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM
Uniprot:: P01116
Synonyme:: 'C-K-RAS;C-K-RAS;c-Ki-ras;c-Ki-ras2;c-Kirsten-ras protein;cellular c-Ki-ras2 proto-oncogene;cellular transforming proto-oncogene;CFC2;GTPase KRas;K-Ras;K-Ras 2;K-ras p21 protein;K-RAS2A;K-RAS2B;K-RAS4A;K-RAS4B;KI-RAS;Kirsten rat sarcoma viral oncogene homolog;Kirsten rat sarcoma viral proto-oncogene;KRAS1;KRAS2;NS;NS3;OES;oncogene KRAS2;PR310 c-K-ras oncogene;RALD;RASK2;transforming protein p21;v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog
Weitere Details:: This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region.

Versandbedingungen:: Blue Ice