A11856
CD8A Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A11856
- Zusätzliche Namen:
- CD8|CD8A|CD8alpha|Leu2|p32
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 26 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
- Uniprot:
- P01732
- Synonyme:
- CD8;CD8 antigen, alpha polypeptide (p32);Leu2;Leu2 T-lymphocyte antigen;OKT8 T-cell antigen;p32;T cell co-receptor;T-cell antigen Leu2;T-cell surface glycoprotein CD8 alpha chain;T-lymphocyte differentiation antigen T8/Leu-2;T8 T-cell antigen
- Weitere Details:
- The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain. Multiple transcript variants encoding different isoforms have been found for this gene. The major protein isoforms of this gene differ by the presence or absence of a transmembrane domain and thus differ in being a membrane-anchored or secreted protein.
- Versandbedingungen:
- Blue Ice





