A1184
[KO Validated] PML Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A1184
- Zusätzliche Namen:
- ML|MYL|PP8675|RNF71|TRIM19
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 70-130kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPEEAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENL
- Uniprot:
- P29590
- Synonyme:
- E3 SUMO-protein ligase PML;MYL;PML/RARA fusion;PP8675;probable transcription factor PML;promyelocytic leukemia protein;promyelocytic leukemia, inducer of;protein PML;RING finger protein 71;RING-type E3 SUMO transferase PML;RNF71;TRIM19;tripartite motif protein TRIM19;tripartite motif-containing protein 19
- Weitere Details:
- The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Versandbedingungen:
- Blue Ice
![[KO Validated] PML Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1184/A1184_1.jpg)
![[KO Validated] PML Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1184/A1184_H330_KO-WB_01.jpg)
![[KO Validated] PML Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1184/A1184_N4576-5_IF_03.jpg)
![[KO Validated] PML Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1184/A1184_N4576-5_IF_04.jpg)