ISG15 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1182
Zusätzliche Namen:: G1P2|hUCRP|IFI15|IMD38|IP17|ISG15|UCRP
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 15kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS
Uniprot:: P05161
Synonyme:: G1P2;hUCRP;IFI15;IMD38;Interferon-induced 15 kDa protein;Interferon-induced 17 kDa protein;interferon-induced 17-kDa/15-kDa protein;interferon-stimulated protein, 15 kDa;interferon, alpha-inducible protein (clone IFI-15K);IP17;ubiquitin cross-reactive protein;ubiquitin-like protein ISG15;UCRP
Weitere Details:: The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted.

Versandbedingungen:: Blue Ice