A1177
EpCAM Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A1177
- Zusätzliche Namen:
- Ber-Ep4|BerEp4|DIAR5|EGP-2|EGP314|EGP40|EpCAM|ESA|HNPCC8|KS1/4|KSA|LYNCH8|M4S1|MIC18|MK-1|MOC-31|TACSTD1|TROP1
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 35-45kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
- Uniprot:
- P16422
- Synonyme:
- adenocarcinoma-associated antigen;cell surface glycoprotein Trop-1;DIAR5;EGP-2;EGP314;EGP40;epithelial cell adhesion molecule;Epithelial cell surface antigen;Epithelial glycoprotein;epithelial glycoprotein 314;ESA;HNPCC8;human epithelial glycoprotein-2;KS 1/4 antigen;KS1/4;KSA;M4S1;major gastrointestinal tumor-associated protein GA733-2;membrane component, chromosome 4, surface marker (35kD glycoprotein);MIC18;MK-1;TACSTD1;TROP1;trophoblast cell surface antigen 1;tumor-associated calcium signal transducer 1
- Weitere Details:
- This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.
- Versandbedingungen:
- Blue Ice