STUB1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A11751
Zusätzliche Namen:: CHIP|HSPABP2|NY-CO-7|SCA48|SCAR16|SDCCAG7|STUB1|UBOX1
Anwendung:: ELISA, WB, IF, ICC, IP
Molekulargewicht:: 34kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
Uniprot:: Q9UNE7
Synonyme:: antigen NY-CO-7;carboxy terminus of Hsp70-interacting protein;CHIP;CLL-associated antigen KW-8;E3 ubiquitin-protein ligase CHIP;heat shock protein A binding protein 2 (c-terminal);HSPABP2;NY-CO-7;RING-type E3 ubiquitin transferase CHIP;SCA48;SCAR16;SDCCAG7;serologically defined colon cancer antigen 7;STIP1 homology and U box-containing protein 1;STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase;UBOX1
Weitere Details:: This gene encodes a protein containing tetratricopeptide repeat and a U-box that functions as a ubiquitin ligase/cochaperone. The encoded protein binds to and ubiquitinates shock cognate 71 kDa protein (Hspa8) and DNA polymerase beta (Polb), among other targets. Mutations in this gene cause spinocerebellar ataxia, autosomal recessive 16. Alternative splicing results in multiple transcript variants. There is a pseudogene for this gene on chromosome 2.

Versandbedingungen:: Blue Ice