A11728
AKAP7 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A11728
- Zusätzliche Namen:
- AKAP15|AKAP18|AKAP7
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 14kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK
- Uniprot:
- O43687, Q9P0M2
- Synonyme:
- A kinase (PRKA) anchor protein 7;A-kinase anchor protein 18 kDa;A-kinase anchor protein 9 kDa;A-kinase anchoring protein 7;AKAP 18;AKAP15;AKAP18;Protein kinase A-anchoring protein 7 isoform gamma;Protein kinase A-anchoring protein 7 isoforms alpha/beta
- Weitere Details:
- This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described.
- Versandbedingungen:
- Blue Ice