SPTLC2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A11716
Zusätzliche Namen:: hLCB2a|HSN1C|LCB2|LCB2A|NSAN1C|SPT2|SPTLC2
Anwendung:: ELISA, WB
Molekulargewicht:: 58kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MKCIMGQDGTSLGKECVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSRHRLVPLLDRPFDETTYEETED
Uniprot:: O15270
Synonyme:: hLCB2a;HSN1C;LCB 2;LCB2;LCB2A;Long chain base biosynthesis protein 2;long chain base biosynthesis protein 2a;NSAN1C;serine palmitoyltransferase 2;serine palmitoyltransferase, subunit II;serine-palmitoyl-CoA transferase 2;SPT 2;SPT2
Weitere Details:: This gene encodes a long chain base subunit of serine palmitoyltransferase. Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It catalyzes the pyridoxal-5-prime-phosphate-dependent condensation of L-serine and palmitoyl-CoA to 3-oxosphinganine. Mutations in this gene were identified in patients with hereditary sensory neuropathy type I.