A11701
HMBS Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A11701
- Zusätzliche Namen:
- HMBS|PBG-D|PBGD|PORC|UPS
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 45-50kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNI
- Uniprot:
- P08397
- Synonyme:
- Hydroxymethylbilane synthase;PBG-D;PBGD;PORC;porphobilinogen deaminase;porphyria, acute; Chester type;pre-uroporphyrinogen synthase;UPS;uroporphyrinogen I synthase;uroporphyrinogen I synthetase
- Weitere Details:
- This gene encodes a member of the hydroxymethylbilane synthase superfamily. The encoded protein is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. Mutations in this gene are associated with the autosomal dominant disease acute intermittent porphyria. Alternatively spliced transcript variants encoding different isoforms have been described.
- Versandbedingungen:
- Blue Ice



