HSP47/SERPINH1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A11698
Zusätzliche Namen:: AsTP3|CBP1|CBP2|gp46|HSP47|HSP47/SERPINH1|OI10|PIG14|PPROM|RA-A47|SERPINH2
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 46kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFELDTDGNPFDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDEL
Uniprot:: P50454
Synonyme:: 47 kDa heat shock protein;arsenic-transactivated protein 3;AsTP3;CBP1;CBP2;cell proliferation-inducing gene 14 protein;collagen binding protein 1;Collagen-binding protein;colligin-1;colligin-2;gp46;HSP47;OI10;PIG14;PPROM;RA-A47;rheumatoid arthritis antigen A-47;rheumatoid arthritis-related antigen RA-A47;serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1);serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 2, (collagen-binding protein 2);serpin H1;serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1);SERPINH2
Weitere Details:: This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The encoded protein is localized to the endoplasmic reticulum and plays a role in collagen biosynthesis as a collagen-specific molecular chaperone. Autoantibodies to the encoded protein have been found in patients with rheumatoid arthritis. Expression of this gene may be a marker for cancer, and nucleotide polymorphisms in this gene may be associated with preterm birth caused by preterm premature rupture of membranes. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9.

Versandbedingungen:: Blue Ice