MTSS1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A11697
Zusätzliche Namen:: MIM|MIMA|MIMB|MTSS1
Anwendung:: ELISA, WB
Molekulargewicht:: 115kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LPAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSPRDTPQGED
Uniprot:: O43312
Synonyme:: metastasis suppressor 1;metastasis suppressor protein 1;metastasis suppressor YGL-1;MIM;MIMA;MIMB;missing in metastasis protein;MTSS1, I-BAR domain containing;protein MTSS 1
Weitere Details:: Enables actin monomer binding activity; identical protein binding activity; and signaling receptor binding activity. Predicted to be involved in cellular response to fluid shear stress; negative regulation of epithelial cell proliferation; and urogenital system development. Predicted to act upstream of or within several processes, including actin filament polymerization; adherens junction maintenance; and magnesium ion homeostasis. Located in actin cytoskeleton.