A11688
SLC25A12 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A11688
- Zusätzliche Namen:
- AGC1|ARALAR|DEE39|EIEE39|SLC25A12
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 75kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLLAGVADQTKDGLISYQEFLAFESVLCAPDSMFIVAFQLFDKSGNGEVTFENVKEIFGQTIIHHHIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGL
- Uniprot:
- O75746
- Synonyme:
- AGC1;araceli hiperlarga;ARALAR;calcium binding mitochondrial carrier superfamily member Aralar1;calcium-binding mitochondrial carrier protein Aralar1;DEE39;EIEE39;mitochondrial aspartate glutamate carrier 1;solute carrier family 25 (aspartate/glutamate carrier), member 12;solute carrier family 25 (mitochondrial carrier, Aralar), member 12;Solute carrier family 25 member 12
- Weitere Details:
- This gene encodes a calcium-binding mitochondrial carrier protein. The encoded protein localizes to the mitochondria and is involved in the exchange of aspartate for glutamate across the inner mitochondrial membrane. Polymorphisms in this gene may be associated with autism, and mutations in this gene may also be a cause of global cerebral hypomyelination. Alternatively spliced transcript variants have been observed for this gene.
- Versandbedingungen:
- Blue Ice

