A11675
SLC12A2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A11675
- Zusätzliche Namen:
- BSC|BSC-2|BSC2|CCC1|KILQS|NKCC1|PPP1R141|SLC12A2
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 160-200kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GEASGESEPAKGSEEAKGRFRVNFVDPAASSSAEDSLSDAAGVGVDGPNVSFQNGGDTVLSEGSSLHSGGGGGSGHHQHYYYDTHTNTYYLRTFGHNTMDAVPRIDHYRHTAAQLGEKLLRPSLAELHDELEKEPFEDGFANGEESTPTRDAVVTYTAESK
- Uniprot:
- P55011
- Synonyme:
- basolateral Na-K-Cl symporter;BSC;BSC2;bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1;bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2;KILQS;NKCC1;PPP1R141;protein phosphatase 1, regulatory subunit 141;solute carrier family 12 (sodium/potassium/chloride transporter), member 2;solute carrier family 12 (sodium/potassium/chloride transporters), member 2;solute carrier family 12 member 2
- Weitere Details:
- The protein encoded by this gene mediates sodium and chloride transport and reabsorption. The encoded protein is a membrane protein and is important in maintaining proper ionic balance and cell volume. This protein is phosphorylated in response to DNA damage. Three transcript variants encoding two different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice





