SLC12A2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A11675
Zusätzliche Namen:: BSC|BSC-2|BSC2|CCC1|KILQS|NKCC1|PPP1R141|SLC12A2
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 160-200kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GEASGESEPAKGSEEAKGRFRVNFVDPAASSSAEDSLSDAAGVGVDGPNVSFQNGGDTVLSEGSSLHSGGGGGSGHHQHYYYDTHTNTYYLRTFGHNTMDAVPRIDHYRHTAAQLGEKLLRPSLAELHDELEKEPFEDGFANGEESTPTRDAVVTYTAESK
Uniprot:: P55011
Synonyme:: basolateral Na-K-Cl symporter;BSC;BSC2;bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1;bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2;KILQS;NKCC1;PPP1R141;protein phosphatase 1, regulatory subunit 141;solute carrier family 12 (sodium/potassium/chloride transporter), member 2;solute carrier family 12 (sodium/potassium/chloride transporters), member 2;solute carrier family 12 member 2
Weitere Details:: The protein encoded by this gene mediates sodium and chloride transport and reabsorption. The encoded protein is a membrane protein and is important in maintaining proper ionic balance and cell volume. This protein is phosphorylated in response to DNA damage. Three transcript variants encoding two different isoforms have been found for this gene.