SEC61A1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A11658
Zusätzliche Namen:: ADTKD5|HNFJ4|HSEC61|SEC61|SEC61A|SEC61A1
Anwendung:: ELISA, WB
Molekulargewicht:: 52kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLEDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTA
Uniprot:: P61619
Synonyme:: ADTKD5;HNFJ4;HSEC61;protein transport protein SEC61 alpha subunit;protein transport protein Sec61 subunit alpha;protein transport protein Sec61 subunit alpha isoform 1;SEC61;Sec61 alpha 1 subunit;Sec61 alpha-1;sec61 homolog;SEC61 translocon alpha 1 subunit;SEC61A
Weitere Details:: The protein encoded by this gene belongs to the SECY/SEC61- alpha family. It appears to play a crucial role in the insertion of secretory and membrane polypeptides into the endoplasmic reticulum. This protein found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins. This gene encodes an alpha subunit of the heteromeric SEC61 complex, which also contains beta and gamma subunits.