APOBEC3D Rabbit polyclonal antibody

Größe

£152.00

SKU:: A11648
Zusätzliche Namen:: A3D|A3DE|APOBEC3D|APOBEC3DE|APOBEC3E|ARP6
Anwendung:: ELISA, WB
Molekulargewicht:: 43kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AMYPHIFYFHFKNLLKACGRNESWLCFTMEVTKHHSAVFRKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVKIMGYKDFVSCWKNFVYSDDEPFKPWKGLQTNFRLLKRRLREILQ
Uniprot:: Q96AK3
Synonyme:: A3D;A3DE;APOBEC3DE;APOBEC3E;apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D;apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3E pseudogene;ARP6;DNA dC->dU-editing enzyme APOBEC-3D;probable DNA dC->dU-editing enzyme APOBEC-3D
Weitere Details:: This gene is a member of the cytidine deaminase gene family. It is one of a group of related genes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.