A11641
FKBP12 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A11641
- Zusätzliche Namen:
- FKBP-12|FKBP-1A|FKBP1|FKBP12|PKC12|PKCI2|PPIASE
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 14kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
- Uniprot:
- P62942
- Synonyme:
- 12 kDa FK506-binding protein;12 kDa FKBP;calstabin-1;FK506 binding protein 1A, 12kDa;FK506 binding protein12;FK506-binding protein 1;FK506-binding protein 12;FK506-binding protein 1A;FK506-binding protein, T-cell, 12-kD;FKBP-12;FKBP-1A;FKBP1;FKBP12;FKBP12-Exip3;immunophilin FKBP12;peptidyl-prolyl cis-trans isomerase FKBP1A;PKC12;PKCI2;PPIASE;PPIase FKBP1A;protein kinase C inhibitor 2;rotamase
- Weitere Details:
- The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed.
- Versandbedingungen:
- Blue Ice



