OCIAD1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A11630
Zusätzliche Namen:: ASRIJ|OCIA|OCIAD1|TPA018
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 28kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE
Uniprot:: Q9NX40
Synonyme:: ASRIJ;OCIA;OCIA domain-containing protein 1;ovarian cancer immunoreactive antigen domain containing 1;ovarian cancer immunoreactive antigen domain containing 1A;ovarian carcinoma immunoreactive antigen;TPA018
Weitere Details:: Predicted to be involved in several processes, including hematopoietic stem cell homeostasis; positive regulation of receptor signaling pathway via JAK-STAT; and regulation of stem cell differentiation. Located in membrane.