A11629
NUP85 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A11629
- Zusätzliche Namen:
- FROUNT|NPHS17|Nup75|NUP85
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 70kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- CPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCERGCFSDLDLIDNLGPAMMLSDRLTFLGKYREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLTSRRPVHGESDTEQLQDDDIETTKVEMLRLSLARNLARAIIREGSLEGS
- Uniprot:
- Q9BW27
- Synonyme:
- 85 kDa nucleoporin;FROUNT;NPHS17;nuclear pore complex protein Nup85;nucleoporin 85kDa;nucleoporin Nup75;nucleoporin Nup85;Nup75;Pericentrin-1
- Weitere Details:
- This gene encodes a protein component of the Nup107-160 subunit of the nuclear pore complex. Nuclear pore complexes are embedded in the nuclear envelope and promote bidirectional transport of macromolecules between the cytoplasm and nucleus. The encoded protein can also bind to the C-terminus of chemokine (C-C motif) receptor 2 (CCR2) and promote chemotaxis of monocytes, thereby participating in the inflammatory response. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

