A11623
EXOSC3 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A11623
- Zusätzliche Namen:
- bA3J10.7|CGI-102|EXOSC3|hRrp-40|p10|PCH1B|RRP40|Rrp40p
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 30kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
- Uniprot:
- Q9NQT5
- Synonyme:
- bA3J10.7;CGI-102;exosome complex component RRP40;exosome complex exonuclease RRP40;Exosome component 3;hRrp-40;p10;PCH1B;ribosomal RNA-processing protein 40;RRP40;Rrp40p
- Weitere Details:
- This gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in numerous RNA processing and degradation activities. Related pseudogenes of this gene are found on chromosome 19 and 21. Alternatively spliced transcript variants encoding different isoforms have been described.
- Versandbedingungen:
- Blue Ice

