A11621
CHMP1A Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A11621
- Zusätzliche Namen:
- CHMP1|CHMP1A|PCH8|PCOLN3|PRSM1|VPS46-1|VPS46A
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 35kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN
- Uniprot:
- Q9HD42
- Synonyme:
- charged multivesicular body protein 1/chromatin modifying protein 1;charged multivesicular body protein 1a;CHMP1;chromatin modifying protein 1A;Chromatin-modifying protein 1a;PCH8;PCOLN3;procollagen (type III) N-endopeptidase;protease, metallo, 1, 33kD;PRSM1;vacuolar protein sorting-associated protein 46-1;VPS46-1;VPS46A
- Weitere Details:
- This gene encodes a member of the CHMP/Chmp family of proteins which are involved in multivesicular body sorting of proteins to the interiors of lysosomes. The initial prediction of the protein sequence encoded by this gene suggested that the encoded protein was a metallopeptidase. The nomenclature has been updated recently to reflect the correct biological function of this encoded protein. Several transcripts encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice