A1162
[KO Validated] HNRNPA2B1 Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A1162
- Zusätzliche Namen:
- B1|HNRNPA2|HNRNPB1|HNRPA2|HNRPA2B1|HNRPB1|IBMPFD2|RNPA2|SNRPB1
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 36-38kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGH
- Uniprot:
- P22626
- Synonyme:
- epididymis secretory sperm binding protein;heterogeneous nuclear ribonucleoproteins A2/B1;hnRNP A2 / hnRNP B1;HNRNPA2;HNRNPA2B1/MYC fusion;HNRNPB1;HNRPA2;HNRPA2B1;HNRPB1;IBMPFD2;nuclear ribonucleoprotein particle A2 protein;RNPA2;SNRPB1
- Weitere Details:
- This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. This gene has been described to generate two alternatively spliced transcript variants which encode different isoforms.
- Versandbedingungen:
- Blue Ice
![[KO Validated] HNRNPA2B1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1162/A1162_1.jpg)
![[KO Validated] HNRNPA2B1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1162/A1162_2.jpg)
![[KO Validated] HNRNPA2B1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1162/A1162_3.jpg)
![[KO Validated] HNRNPA2B1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1162/A1162_4.jpg)
![[KO Validated] HNRNPA2B1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1162/A1162_5.jpg)
![[KO Validated] HNRNPA2B1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1162/A1162_H208_KO-WB_01.jpg)
![[KO Validated] HNRNPA2B1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1162/A1162_N25651-4_WB_01.jpg)
![[KO Validated] HNRNPA2B1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1162/A1162_N25650-4_IHC_03.jpg)
![[KO Validated] HNRNPA2B1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1162/A1162_N25650-4_IHC_02.jpg)