A11596
DIAPH1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A11596
- Zusätzliche Namen:
- DFNA1|DIA1|DIAPH1|DRF1|hDIA1|LFHL1|mDia1|SCBMS
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 160 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEPPGGSLGPGRGTRDKKKGRSPDELPSAGGDGGKSKKFTLKRLMADELERFTSMRIKKEKEKPNSAHRNSSASYGDDPTAQSLQDVSDEQVLVLFEQML
- Uniprot:
- O60610
- Synonyme:
- DFNA1;DIA1;Diaphanous-related formin-1;DRF1;hDIA1;LFHL1;protein diaphanous homolog 1;SCBMS
- Weitere Details:
- This gene is a homolog of the Drosophila diaphanous gene, and has been linked to autosomal dominant, fully penetrant, nonsyndromic sensorineural progressive low-frequency hearing loss. Actin polymerization involves proteins known to interact with diaphanous protein in Drosophila and mouse. It has therefore been speculated that this gene may have a role in the regulation of actin polymerization in hair cells of the inner ear. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice