ICT1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A11590
Zusätzliche Namen:: DS-1|DS1|ICT1|MRP-L58
Anwendung:: ELISA, WB
Molekulargewicht:: 24kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD
Uniprot:: Q14197
Synonyme:: 39S ribosomal protein L58, mitochondrial;digestion substraction 1;DS-1;DS1;ICT1;immature colon carcinoma transcript 1 protein;mitochondrial large ribosomal subunit protein ICT1;mitochondrial large ribosomal subunit protein mL62;MRP-L58;peptidyl-tRNA hydrolase ICT1, mitochondrial
Weitere Details:: The protein encoded by this gene is a peptidyl-tRNA hydrolase and a vital component of the large mitochondrial ribosome. The encoded protein serves as a ribosome release factor for this ribosome, which translates mitochondrial genes. This protein may be responsible for degrading prematurely-terminated polypeptides and for reusing stalled ribosomes. Two transcript variants encoding different isoforms have been found for this gene.