A11589
HEPACAM Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A11589
- Zusätzliche Namen:
- GlialCAM|HEPACAM|HEPN1|MLC2A|MLC2B
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 70kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- NITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCMVENPISQGRSLPVKITVYRRSSLYIIL
- Uniprot:
- Q14CZ8
- Synonyme:
- GlialCAM;hepatocyte cell adhesion molecule;HEPN1;MLC2A;MLC2B;protein hepaCAM;Putative cancer susceptibility gene HEPN1 protein
- Weitere Details:
- The protein encoded by this gene is a single-pass type I membrane protein that localizes to the cytoplasmic side of the cell membrane. The encoded protein acts as a homodimer and is involved in cell motility and cell-matrix interactions. The expression of this gene is downregulated or undetectable in many cancer cell lines, so this may be a tumor suppressor gene.
- Versandbedingungen:
- Blue Ice

