Tropomyosin 1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1157
Zusätzliche Namen:: C15orf13|CMD1Y|CMH3|HEL-S-265|HTM-alpha|LVNC9|TMSA|Tropomyosin 1
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 36kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAGSSSLEAVRRKIRSLQEQADAAEERAGTLQRELDHERKLRETAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED
Uniprot:: P09493
Synonyme:: Alpha-tropomyosin;C15orf13;cardiomyopathy, hypertrophic 3;CMD1Y;CMH3;epididymis secretory protein Li 265;HEL-S-265;HTM-alpha;LVNC9;sarcomeric tropomyosin kappa;TMSA;tropomyosin alpha-1 chain;Tropomyosin-1
Weitere Details:: This gene is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The encoded protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction. In smooth muscle and non-muscle cells, alternatively spliced transcript variants encoding a range of isoforms have been described. Mutations in this gene are associated with type 3 familial hypertrophic cardiomyopathy and dilated cardiomyopathy 1Y.

Versandbedingungen:: Blue Ice