hnRNP A1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A11564
Zusätzliche Namen:: ALS19|ALS20|hnRNP A1|hnRNP-A1|HNRPA1|HNRPA1L3|IBMPFD3|UP 1
Anwendung:: ELISA, WB, IHC-P, IF, ICC, IP
Molekulargewicht:: 30kDa/34kDa/39kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAK
Uniprot:: P09651
Synonyme:: ALS19;ALS20;epididymis secretory sperm binding protein;helix-destabilizing protein;heterogeneous nuclear ribonucleoprotein A1;heterogeneous nuclear ribonucleoprotein A1B protein;heterogeneous nuclear ribonucleoprotein B2 protein;heterogeneous nuclear ribonucleoprotein core protein A1;hnRNP A1;hnRNP core protein A1;hnRNP core protein A1-like 3;hnRNP-A1;HNRPA1;HNRPA1L3;IBMPFD3;nuclear ribonucleoprotein particle A1 protein;putative heterogeneous nuclear ribonucleoprotein A1-like 3;single-strand DNA-binding protein UP1;single-strand RNA-binding protein;UP 1
Weitere Details:: This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome.hnRNP A1 has three isoforms with MW 30 kDa, 34 kDa and 39 kDa.

Versandbedingungen:: Blue Ice