A11533
BACE1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A11533
- Zusätzliche Namen:
- ASP2|BACE|BACE1|HSPC104
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 70kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- FYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQWRCLRCLRQQHDDFADDISLLK
- Uniprot:
- P56817
- Synonyme:
- APP beta-secretase;asp 2;ASP2;aspartyl protease 2;BACE;beta-secretase 1;beta-secretase 1 precursor variant 1;beta-site amyloid beta A4 precursor protein-cleaving enzyme;Beta-site amyloid precursor protein cleaving enzyme 1;beta-site APP cleaving enzyme 1;beta-site APP-cleaving enzyme;HSPC104;memapsin-2;membrane-associated aspartic protease 2;transmembrane aspartic proteinase Asp2
- Weitere Details:
- This gene encodes a member of the peptidase A1 family of aspartic proteases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protease. This transmembrane protease catalyzes the first step in the formation of amyloid beta peptide from amyloid precursor protein. Amyloid beta peptides are the main constituent of amyloid beta plaques, which accumulate in the brains of human Alzheimer's disease patients.
- Versandbedingungen:
- Blue Ice