A11512
B Beta-Catenin Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A11512
- Zusätzliche Namen:
- armadillo|CTNNB|EVR7|MRD19|NEDSDV|B Beta-Catenin
- Anwendung:
- ELISA, WB, IHC-P, IP
- Molekulargewicht:
- 92kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
- Uniprot:
- P35222
- Synonyme:
- armadillo;Beta-catenin;catenin (cadherin-associated protein), beta 1, 88kDa;catenin beta-1;CTNNB;EVR7;MRD19;NEDSDV
- Weitere Details:
- The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice





