A1150
CELF1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A1150
- Zusätzliche Namen:
- BRUNOL2|CELF1|CUG-BP|CUGBP|CUGBP1|EDEN-BP|hNab50|NAB50|NAPOR
- Anwendung:
- ELISA, WB, IP
- Molekulargewicht:
- 52kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSE
- Uniprot:
- Q92879
- Synonyme:
- 50 kDa nuclear polyadenylated RNA-binding protein;bruno-like 2;bruno-like protein 2;BRUNOL2;CUG RNA-binding protein;CUG triplet repeat RNA-binding protein 1;CUG-BP;CUG-BP- and ETR-3-like factor 1;CUGBP;CUGBP Elav-like family member 1;CUGBP1;deadenylation factor CUG-BP;EDEN-BP;EDEN-BP homolog;embryo deadenylation element binding protein;embryo deadenylation element-binding protein homolog;hNab50;NAB50;NAPOR;nuclear polyadenylated RNA-binding protein, 50-kD;RNA-binding protein BRUNOL-2
- Weitere Details:
- Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Versandbedingungen:
- Blue Ice