Lamin B1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A11495
Zusätzliche Namen:: ADLD|LMN|LMN2|LMNB|MCPH26
Anwendung:: WB, IHC-P
Molekulargewicht:: 45kDa/70kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTI
Uniprot:: P20700
Synonyme:: ADLD;lamin-B1;LMN;LMN2;LMNB;MCPH26
Weitere Details:: This gene encodes one of the two B-type lamin proteins and is a component of the nuclear lamina. A duplication of this gene is associated with autosomal dominant adult-onset leukodystrophy (ADLD). Alternative splicing results in multiple transcript variants.