FGF2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A11488
Zusätzliche Namen:: BFGF|F2|FGF-2|FGFB|HBGF-2
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 18kDa/22kDa/31kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAE
Uniprot:: P09038
Synonyme:: Basic fibroblast growth factor;basic fibroblast growth factor bFGF;BFGF;FGF-2;FGFB;fibroblast growth factor 2;fibroblast growth factor 2 (basic);HBGF-2;heparin-binding growth factor 2;prostatropin
Weitere Details:: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF.

Versandbedingungen:: Blue Ice