A11480
Mast Cell Chymase (CMA1) Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A11480
- Zusätzliche Namen:
- chymase|CYH|Mast Cell Chymase (CMA1)|MCT1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 27kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
- Uniprot:
- P23946
- Synonyme:
- alpha-chymase;chymase;chymase 1 preproprotein transcript E;chymase 1 preproprotein transcript I;chymase 1, mast cell;chymase, heart;chymase, mast cell;CYH;mast cell protease I;MCT1
- Weitere Details:
- This gene encodes a chymotryptic serine proteinase that belongs to the peptidase family S1. It is expressed in mast cells and is thought to function in the degradation of the extracellular matrix, the regulation of submucosal gland secretion, and the generation of vasoactive peptides. In the heart and blood vessels, this protein, rather than angiotensin converting enzyme, is largely responsible for converting angiotensin I to the vasoactive peptide angiotensin II. Alternative splicing results in multiple variants.
- Versandbedingungen:
- Blue Ice