A11475
MCM3 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A11475
- Zusätzliche Namen:
- HCC5|MCM3|P1-MCM3|P1.h|RLFB
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC, IP
- Molekulargewicht:
- 100kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYV
- Uniprot:
- P25205
- Synonyme:
- cervical cancer proto-oncogene 5;DNA polymerase alpha holoenzyme-associated protein P1;DNA replication factor MCM3;DNA replication licensing factor MCM3;HCC5;hRlf beta subunit;MCM3 minichromosome maintenance deficient 3;minichromosome maintenance deficient 3;P1-MCM3;P1.h;p102;replication licensing factor, beta subunit;RLF subunit beta;RLFB
- Weitere Details:
- The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with and is acetylated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. Several transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice