NEUROD1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1147
Zusätzliche Namen:: BETA2|BHF-1|bHLHa3|MODY6|NEUROD|NEUROD1|T2D
Anwendung:: ELISA, WB
Molekulargewicht:: 45kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQNQDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFTMHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFHD
Uniprot:: Q13562
Synonyme:: basic helix-loop-helix transcription factor;beta-cell E-box transactivator 2;BETA2;BHF-1;bHLHa3;class A basic helix-loop-helix protein 3;MODY6;NEUROD;neurogenic differentiation factor 1;neurogenic helix-loop-helix protein NEUROD;T2D
Weitere Details:: This gene encodes a member of the NeuroD family of basic helix-loop-helix (bHLH) transcription factors. The protein forms heterodimers with other bHLH proteins and activates transcription of genes that contain a specific DNA sequence known as the E-box. It regulates expression of the insulin gene, and mutations in this gene result in type II diabetes mellitus.