SH2D1A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1143
Zusätzliche Namen:: DSHP|EBVS|IMD5|LYP|MTCP1|SAP|SAP/SH2D1A|SH2D1A|XLP|XLPD|XLPD1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 17kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
Uniprot:: O60880
Synonyme:: DSHP;Duncan disease SH2-protein;EBVS;IMD5;LYP;MTCP1;SAP;SAP/SH2D1A;SH2 domain-containing protein 1A;signaling lymphocyte activation molecule-associated protein;signaling lymphocytic activation molecule-associated protein;SLAM associated protein/SH2 domain protein 1A;SLAM-associated protein;T cell signal transduction molecule SAP;T-cell signal transduction molecule SAP;XLP;XLPD;XLPD1
Weitere Details:: This gene encodes a protein that plays a major role in the bidirectional stimulation of T and B cells. This protein contains an SH2 domain and a short tail. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in this gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice