RAC2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1139
Zusätzliche Namen:: EN-7|Gx|HSPC022|IMD73A|IMD73B|IMD73C|p21-Rac2|RAC2
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 21 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL
Uniprot:: P15153
Synonyme:: EN-7;Gx;HSPC022;IMD73A;IMD73B;IMD73C;p21-Rac2;ras-related C3 botulinum toxin substrate 2;ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);Ras-related C3 botulinum toxin substrate 3 (rho family, small GTP-binding protein Rac2);small G protein
Weitere Details:: This gene encodes a member of the Ras superfamily of small guanosine triphosphate (GTP)-metabolizing proteins. The encoded protein localizes to the plasma membrane, where it regulates diverse processes, such as secretion, phagocytosis, and cell polarization. Activity of this protein is also involved in the generation of reactive oxygen species. Mutations in this gene are associated with neutrophil immunodeficiency syndrome. There is a pseudogene for this gene on chromosome 6.

Versandbedingungen:: Blue Ice