A1138
MCM7 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A1138
- Zusätzliche Namen:
- CDC47|MCM2|MCM7|P1.1-MCM3|P1CDC47|P85MCM|PNAS146|PPP1R104
- Anwendung:
- ELISA, WB, IF, ICC, IP
- Molekulargewicht:
- 81kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVRSPQNQYPAELMRRFELYFQG
- Uniprot:
- P33993
- Synonyme:
- CDC47;CDC47 homolog;DNA replication licensing factor MCM7;homolog of S. cerevisiae Cdc47;MCM2;minichromosome maintenance deficient 7;P1.1-MCM3;P1CDC47;P85MCM;PNAS146;PPP1R104;protein phosphatase 1, regulatory subunit 104
- Weitere Details:
- The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate with this protein, and may regulate the binding of this protein with the tumorsuppressor protein RB1/RB. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
- Versandbedingungen:
- Blue Ice





