A11355
mTOR Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A11355
- Zusätzliche Namen:
- FRAP|FRAP1|FRAP2|mTOR|RAFT1|RAPT1|SKS
- Anwendung:
- ELISA, WB, IF, ICC, IP
- Molekulargewicht:
- 289kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- CHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQI
- Uniprot:
- P42345
- Synonyme:
- FK506 binding protein 12-rapamycin associated protein 2;FK506-binding protein 12-rapamycin complex-associated protein 1;FKBP-rapamycin associated protein;FKBP12-rapamycin complex-associated protein;FKBP12-rapamycin complex-associated protein 1;FRAP;FRAP1;FRAP2;mammalian target of rapamycin;Mechanistic target of rapamycin;mechanistic target of rapamycin (serine/threonine kinase);RAFT1;rapamycin and FKBP12 target 1;rapamycin associated protein FRAP2;rapamycin target protein 1;RAPT1;serine/threonine-protein kinase mTOR;SKS
- Weitere Details:
- The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This kinase is a component of two distinct complexes, mTORC1, which controls protein synthesis, cell growth and proliferation, and mTORC2, which is a regulator of the actin cytoskeleton, and promotes cell survival and cell cycle progression. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. Inhibitors of mTOR are used in organ transplants as immunosuppressants, and are being evaluated for their therapeutic potential in SARS-CoV-2 infections. Mutations in this gene are associated with Smith-Kingsmore syndrome and somatic focal cortical dysplasia type II. The ANGPTL7 gene is located in an intron of this gene.
- Versandbedingungen:
- Blue Ice




(jia2)_WB_01.jpg)
_IF_01.jpg)
_IF_02.jpg)
