A1135
E2F8 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A1135
- Zusätzliche Namen:
- E2F-8|E2F8
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 105kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PVPGQSQPNGQSVAVTGAQQPVPVTPKGSQLVAESFFRTPGGPTKPTSSSCMDFEGANKTSLGTLFVPQRKLEVSTEDVH
- Uniprot:
- A0AVK6
- Synonyme:
- E2F family member 8;E2F-8;transcription factor E2F8
- Weitere Details:
- This gene encodes a member of a family of transcription factors which regulate the expression of genes required for progression through the cell cycle. The encoded protein regulates progression from G1 to S phase by ensuring the nucleus divides at the proper time. Multiple alternatively spliced variants, encoding the same protein, have been identified.
- Versandbedingungen:
- Blue Ice

