Ephrin B2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A11349
Zusätzliche Namen:: Ephrin B2|ephrin-B2|EPLG5|Htk-L|HTKL|LERK5
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLN
Uniprot:: P52799
Synonyme:: eph-related receptor tyrosine kinase ligand 5;ephrin-B2;EPLG5;HTK ligand;Htk-L;HTKL;LERK5;ligand of eph-related kinase 5
Weitere Details:: This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNB class ephrin which binds to the EPHB4 and EPHA3 receptors.