CXCR3 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A11294
Zusätzliche Namen:: CD182|CD183|CKR-L2|CMKAR3|CXCR3|GPR9|IP10-R|Mig-R|MigR
Anwendung:: ELISA, WB
Molekulargewicht:: 46kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK
Uniprot:: P49682
Synonyme:: C-X-C chemokine receptor type 3;CD182;CD183;chemokine (C-X-C motif) receptor 3;chemokine receptor 3;CKR-L2;CMKAR3;G protein-coupled receptor 9;GPR9;interferon-inducible protein 10 receptor;IP-10 receptor;IP10-R;Mig receptor;Mig-R;MigR
Weitere Details:: This gene encodes a G protein-coupled receptor with selectivity for three chemokines, termed CXCL9/Mig (monokine induced by interferon-g), CXCL10/IP10 (interferon-g-inducible 10 kDa protein) and CXCL11/I-TAC (interferon-inducible T cell a-chemoattractant). Binding of chemokines to this protein induces cellular responses that are involved in leukocyte traffic, most notably integrin activation, cytoskeletal changes and chemotactic migration. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the isoforms (CXCR3-B) shows high affinity binding to chemokine, CXCL4/PF4 (PMID:12782716).

Versandbedingungen:: Blue Ice