LC3B Rabbit polyclonal antibody

Größe

£152.00

SKU:: A11282
Zusätzliche Namen:: ATG8F|LC3B|MAP1A/1BLC3|MAP1LC3B-a
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 14kDa,16kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYE
Uniprot:: Q9GZQ8
Synonyme:: ATG8F;Autophagy-related protein LC3 B;autophagy-related ubiquitin-like modifier LC3 B;LC3B;MAP1 light chain 3-like protein 2;MAP1A/1BLC3;MAP1A/MAP1B LC3 B;MAP1A/MAP1B light chain 3 B;MAP1LC3B-a;Microtubule-associated protein 1 light chain 3 beta;microtubule-associated proteins 1A/1B light chain 3B
Weitere Details:: The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.