A11270
IDH2 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A11270
- Zusätzliche Namen:
- D2HGA2|ICD-M|IDH|IDH-2|IDH2|IDHM|IDP|IDPM|mNADP-IDH
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 43kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ
- Uniprot:
- P48735
- Synonyme:
- D2HGA2;ICD-M;IDH;IDHM;IDP;IDPM;isocitrate dehydrogenase (NADP(+)) 2, mitochondrial;isocitrate dehydrogenase [NADP], mitochondrial;isocitrate dehydrogenase 2 (NADP+), mitochondrial;mNADP-IDH;NADP(+)-specific ICDH;oxalosuccinate decarboxylase
- Weitere Details:
- Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice