Cardiac troponin T (TNNT2) Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1126
Zusätzliche Namen:: Cardiac troponin T (TNNT2)|CMD1D|CMH2|CMPD2|cTnT|LVNC6|RCM3|TnTC
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 40 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEEL
Uniprot:: P45379
Synonyme:: Cardiac muscle troponin T;cardiomyopathy, dilated 1D (autosomal dominant);cardiomyopathy, hypertrophic 2;CMD1D;CMH2;CMPD2;cTnT;LVNC6;RCM3;TnTC;troponin T type 2 (cardiac);troponin T, cardiac muscle;truncated cardiac troponin T
Weitere Details:: This gene encodes the cardiac isoform of troponin T. The encoded protein is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy.