A11249
SERPINC1 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A11249
- Zusätzliche Namen:
- AT3|AT3D|ATIII|ATIII-R2|ATIII-T1|ATIII-T2|SERPINC1|THPH7
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 58kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MYSNVIGTVTSGKRKVYLLSLLLIGFWDCVTCHGSPVDICTAKPRDIPMNPMCIYRSPEKKATEDEGSEQKIPEATNRRVWELSKANSRFATTFYQHLAD
- Uniprot:
- P01008
- Synonyme:
- antithrombin-III;AT3;AT3D;ATIII;ATIII-R2;ATIII-T1;ATIII-T2;serine (or cysteine) proteinase inhibitor, clade C (antithrombin), member 1;Serpin C1;serpin peptidase inhibitor clade C member 1;serpin peptidase inhibitor, clade C (antithrombin), member 1;THPH7
- Weitere Details:
- The protein encoded by this gene, antithrombin III, is a plasma protease inhibitor and a member of the serpin superfamily. This protein inhibits thrombin as well as other activated serine proteases of the coagulation system, and it regulates the blood coagulation cascade. The protein includes two functional domains: the heparin binding-domain at the N-terminus of the mature protein, and the reactive site domain at the C-terminus. The inhibitory activity is enhanced by the presence of heparin. Numerous mutations have been identified for this gene, many of which are known to cause antithrombin-III deficiency which constitutes a strong risk factor for thrombosis. A reduction in the serum level of this protein is associated with severe cases of Coronavirus Disease 19 (COVID-19).
- Versandbedingungen:
- Blue Ice





