ATP5A1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A11217
Zusätzliche Namen:: ATP5A|ATP5A1|ATP5AL2|ATPM|COXPD22|hATP1|HEL-S-123m|MC5DN4|MOM2|OMR|ORM
Anwendung:: ELISA, WB, IHC-P, IF, ICC, IP
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF
Uniprot:: P25705
Synonyme:: ATP synthase alpha chain, mitochondrial;ATP synthase F1 subunit alpha;ATP synthase subunit alpha, mitochondrial;ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle;ATP sythase (F1-ATPase) alpha subunit;ATP5A;ATP5A1;ATP5AL2;ATPM;COXPD22;epididymis secretory sperm binding protein Li 123m;hATP1;HEL-S-123m;MC5DN4;mitochondrial ATP synthetase, oligomycin-resistant;MOM2;OMR;ORM
Weitere Details:: This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, using an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the alpha subunit of the catalytic core. Alternatively spliced transcript variants encoding the different isoforms have been identified. Pseudogenes of this gene are located on chromosomes 9, 2, and 16.

Versandbedingungen:: Blue Ice