A11198
Galectin 3/LGALS3 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A11198
- Zusätzliche Namen:
- CBP35|GAL3|GALBP|Galectin 3/LGALS3|GALIG|L31|LGALS2|MAC2
- Anwendung:
- ELISA, WB, IHC-P, IP
- Molekulargewicht:
- 28kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGA
- Uniprot:
- P17931
- Synonyme:
- 35 kDa lectin;advanced glycation end-product receptor 3;carbohydrate-binding protein 35;CBP35;epididymis secretory sperm binding protein;GAL3;galactose-specific lectin 3;Galactoside-binding protein;GALBP;galectin-3;GALIG;IgE-binding protein;L-31;L31;laminin-binding protein;lectin L-29;lectin, galactoside-binding, soluble, 3;LGALS2;MAC-2 antigen;MAC2
- Weitere Details:
- This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix,the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis,innate immunity,cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice