A11195
[KD Validated] FAK Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A11195
- Zusätzliche Namen:
- FADK|FADK 1|FAK|FAK1|FRNK|p125FAK|pp125FAK|PPP1R71
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC, IP
- Molekulargewicht:
- 125Kda/119kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLK
- Uniprot:
- Q05397
- Synonyme:
- FADK;FADK 1;FAK;FAK-related non-kinase polypeptide;FAK1;focal adhesion kinase 1;focal adhesion kinase-related nonkinase;FRNK;p125FAK;pp125FAK;PPP1R71;protein phosphatase 1 regulatory subunit 71;Protein-tyrosine kinase 2;PTK2 protein tyrosine kinase 2
- Weitere Details:
- This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice
![[KD Validated] FAK Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11195/A11195_1.jpg)
![[KD Validated] FAK Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11195/A11195_2.jpg)
![[KD Validated] FAK Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11195/A11195_3.jpg)
![[KD Validated] FAK Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11195/A11195_4.jpg)
![[KD Validated] FAK Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11195/A11195_5.jpg)
![[KD Validated] FAK Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11195/A11195_N11101-4_WB_01.jpg)
![[KD Validated] FAK Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11195/A11195_N11102-8_WB_01.jpg)
![[KD Validated] FAK Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11195/A11195_MP0171_N11102_WB_01.jpg)
![[KD Validated] FAK Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11195/A11195_N11102-4_IHC_01.jpg)