A11163
NF-K KappaB2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A11163
- Zusätzliche Namen:
- CVID10|H2TF1|LYT-10|LYT10|NF-kB2|NF-K KappaB2|p100|p49/p100|p52
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 120kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AGADIHAENEEPLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH
- Uniprot:
- Q00653
- Synonyme:
- CVID10;DNA-binding factor KBF2;H2TF1;lymphocyte translocation chromosome 10 protein;LYT-10;LYT10;NF-kB2;NFKB, p52/p100 subunit;nuclear factor Kappa-B, subunit 2;nuclear factor NF-kappa-B p100 subunit;nuclear factor NF-kappa-B p52 subunit;nuclear factor of Kappa light chain gene enhancer in B cells 2;Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2;nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100);oncogene Lyt-10;p100;p49/p100;p52;transcription factor NFKB2
- Weitere Details:
- This gene encodes a subunit of the transcription factor complex nuclear factor-kappa-B (NFkB). The NFkB complex is expressed in numerous cell types and functions as a central activator of genes involved in inflammation and immune function. The protein encoded by this gene can function as both a transcriptional activator or repressor depending on its dimerization partner. The p100 full-length protein is co-translationally processed into a p52 active form. Chromosomal rearrangements and translocations of this locus have been observed in B cell lymphomas, some of which may result in the formation of fusion proteins. There is a pseudogene for this gene on chromosome 18. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice



